Brand Voice Analysis

Brand Voice Analysis is a Writing skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02

ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo

Install in seconds

Install Brand Voice Analysis

Copy Brand Voice Analysis into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.

terminal

npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/skills/market-brand ~/.claude/skills/market-brand

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file: skills/market-brand/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to: ~/.claude/skills/market-brand
Collection: One of 15 skills cataloged from this repository
Category: Writing — 1012 skills

What Brand Voice Analysis does

Brand Voice Analysis examines a brand's voice, tone, and messaging across its website, social media, and other content to produce actionable brand voice guidelines. Use it to document voice patterns, ensure consistency across channels, or benchmark against competitors.

Brand Voice Analysis is cataloged under Writing on DirSkills. Brand Voice Analysis comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

Excerpt

Brand Voice Analysis and Guidelines Generation

Skill Purpose

Analyze a brand's voice, tone, and messaging across all available channels and generate a comprehensive brand voice guidelines document. This skill examines how a brand communicates, identifies patterns and inconsistencies, and produces actionable guidelines that any writer or marketer can follow to maintain brand consistency.

When to Use

User wants to understand or document a brand's voice
User needs brand voice guidelines for a team, freelancers, or agency
User wants to ensure consistency across marketing channels
User is rebranding or refining their brand identity
User wants to compare their brand voice to competitors
Triggered by /market brand <url> or /market brand

How to Execute

This is the opening of the README. Read the full README on GitHub.

Commands Brand Voice Analysis provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

/market

Frequently asked about Brand Voice Analysis

What else does zubair-trabzada publish alongside Brand Voice Analysis?
Brand Voice Analysis is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Client Proposal Generator, Copywriting Analysis & Generation and Email Sequence Generator. Each one is a separate skill with its own page in this directory, installs the same way Brand Voice Analysis does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.
How does Brand Voice Analysis compare to other Writing skills?
Brand Voice Analysis ranks #242 by stars among the 1012 Writing skills in this catalog. The most-starred ones next to it are Article Writing, Social Media Content Calendar and Knowledge Comic Creator. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of Brand Voice Analysis against them. Open each page to compare what they document and how they install.