Client Proposal Generator

Client Proposal Generator is a Writing skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02

ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo

Install in seconds

Install Client Proposal Generator

Copy Client Proposal Generator into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.

terminal

npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/skills/market-proposal ~/.claude/skills/market-proposal

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file: skills/market-proposal/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to: ~/.claude/skills/market-proposal
Collection: One of 15 skills cataloged from this repository
Category: Writing — 1012 skills

What Client Proposal Generator does

Client Proposal Generator creates professional, client-ready marketing service proposals that include situation analysis, phased strategy, scoped deliverables, pricing with tiered options, and ROI projections. Use it after a discovery call to formalize a prospective client engagement or to generate a reusable proposal template.

Client Proposal Generator is cataloged under Writing on DirSkills. Client Proposal Generator comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

Excerpt

Client Proposal Generator for Marketing Services

Skill Purpose

Generate a professional, client-ready marketing services proposal. This skill produces a complete proposal document that positions the agency/consultant as the clear choice, frames pricing with anchoring and tiered options, and includes ROI projections to justify the investment.

When to Use

User wants to create a proposal for a prospective marketing client
User has completed a discovery call and needs to formalize the engagement
User wants a template for their marketing agency's proposals
Triggered by /market proposal or /market proposal <client name>

How to Execute

Step 1: Gather Proposal Inputs

Collect these details from the user (ask if not provided):

This is the opening of the README. Read the full README on GitHub.

Commands Client Proposal Generator provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

/market

Frequently asked about Client Proposal Generator

What else does zubair-trabzada publish alongside Client Proposal Generator?
Client Proposal Generator is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Brand Voice Analysis, Copywriting Analysis & Generation and Email Sequence Generator. Each one is a separate skill with its own page in this directory, installs the same way Client Proposal Generator does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.
How does Client Proposal Generator compare to other Writing skills?
Client Proposal Generator ranks #243 by stars among the 1012 Writing skills in this catalog. The most-starred ones next to it are Article Writing, Social Media Content Calendar and Knowledge Comic Creator. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of Client Proposal Generator against them. Open each page to compare what they document and how they install.