✍️
WritingPython

Market

by zubair-trabzada

Market is a Writing skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02
ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo
Install in seconds
Install Market
Copy Market into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.
terminal
npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/market ~/.claude/skills/market

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file
market/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to
~/.claude/skills/market
Collection
One of 15 skills cataloged from this repository
Category
Writing1012 skills

What Market does

Market runs marketing audits, generates copy, emails, social content, ads, and client reports from the command line.

Market is cataloged under Writing on DirSkills. Market comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

AI Marketing Suite — Main Orchestrator

You are a comprehensive AI marketing analysis and content generation system for Claude Code. You help entrepreneurs, agency builders, and solopreneurs analyze websites, generate marketing content, audit funnels, create client proposals, and build marketing strategies — all from the command line.

Command Reference

This is the opening of the README. Read the full README on GitHub.

Commands Market provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

  • /market

Frequently asked about Market

  • What else does zubair-trabzada publish alongside Market?

    Market is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Brand Voice Analysis, Client Proposal Generator and Copywriting Analysis & Generation. Each one is a separate skill with its own page in this directory, installs the same way Market does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.

  • How does Market compare to other Writing skills?

    Market ranks #246 by stars among the 1012 Writing skills in this catalog. The most-starred ones next to it are Article Writing, Social Media Content Calendar and Knowledge Comic Creator. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of Market against them. Open each page to compare what they document and how they install.

More from zubair-trabzada/ai-marketing-claude

Market is one of 15 skills cataloged on DirSkills from zubair-trabzada/ai-marketing-claude.

See all 15 skills
🎙️
2w ago

Brand Voice Analysis

Brand Voice Analysis examines a brand's voice, tone, and messaging across its website, social media, and other content to produce actionable brand voice guidelines. Use it to document voice patterns, ensure consistency across channels, or benchmark against competitors.
Writing
2.5K692
📄
2w ago

Client Proposal Generator

Client Proposal Generator creates professional, client-ready marketing service proposals that include situation analysis, phased strategy, scoped deliverables, pricing with tiered options, and ROI projections. Use it after a discovery call to formalize a prospective client engagement or to generate a reusable proposal template.
Writing
2.5K692
✍️
2w ago

Copywriting Analysis & Generation

Copywriting Analysis & Generation analyzes website copy, scores it across clarity, persuasion, specificity, emotion, and action, and generates optimized alternatives with before/after examples using proven copywriting frameworks.
Writing
2.5K692
✉️
2w ago

Email Sequence Generator

Email Sequence Generator creates complete, ready-to-send email sequences with subject lines, body copy, timing, and segmentation strategies. Use it to build welcome, nurture, launch, re-engagement, onboarding, cart abandonment, and cold outreach campaigns based on proven email frameworks.
Writing
2.5K692
📈
2w ago

Landing Page CRO Analysis

Landing Page CRO Analysis audits any landing page URL and produces a section-by-section teardown with prioritized, actionable conversion rate optimization fixes. Use it when asked for landing page feedback, conversion optimization, or a review to improve signups, leads, or purchases.
Frontend
2.5K692
📣
2w ago

Market Ads

Market Ads generates complete ad campaigns across platforms with copy variations, audience targeting strategies, budget recommendations, and creative specifications. Use it after running /market ads <url> to produce production-ready campaign assets.
Writing
2.5K692