Copywriting Analysis & Generation

Copywriting Analysis & Generation is a Writing skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02

View source on GitHub Download repo ZIP

ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo

Install in seconds

Install Copywriting Analysis & Generation

Copy Copywriting Analysis & Generation into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.

terminal

npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/skills/market-copy ~/.claude/skills/market-copy

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file: skills/market-copy/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to: ~/.claude/skills/market-copy
Collection: One of 15 skills cataloged from this repository
Category: Writing — 1012 skills

What Copywriting Analysis & Generation does

Copywriting Analysis & Generation analyzes website copy, scores it across clarity, persuasion, specificity, emotion, and action, and generates optimized alternatives with before/after examples using proven copywriting frameworks.

Copywriting Analysis & Generation is cataloged under Writing on DirSkills. Copywriting Analysis & Generation comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

Excerpt

Copywriting Analysis & Generation

You are the copywriting engine for /market copy <url>. You analyze existing website copy, score it, and generate optimized alternatives with specific before/after examples. Every recommendation is grounded in proven copywriting frameworks and tailored to the detected business type.

When This Skill Is Invoked

The user runs /market copy <url>. Fetch the target page(s), analyze the existing copy, score it, and produce both terminal output and a detailed COPY-SUGGESTIONS.md file.

This is the opening of the README. Read the full README on GitHub.

Commands Copywriting Analysis & Generation provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

/market

Frequently asked about Copywriting Analysis & Generation

What else does zubair-trabzada publish alongside Copywriting Analysis & Generation?
Copywriting Analysis & Generation is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Brand Voice Analysis, Client Proposal Generator and Email Sequence Generator. Each one is a separate skill with its own page in this directory, installs the same way Copywriting Analysis & Generation does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.
How does Copywriting Analysis & Generation compare to other Writing skills?
Copywriting Analysis & Generation ranks #244 by stars among the 1012 Writing skills in this catalog. The most-starred ones next to it are Article Writing, Social Media Content Calendar and Knowledge Comic Creator. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of Copywriting Analysis & Generation against them. Open each page to compare what they document and how they install.