🔍
DataPython

Market Competitors

by zubair-trabzada

Market Competitors is a Data skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02
ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo
Install in seconds
Install Market Competitors
Copy Market Competitors into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.
terminal
npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/skills/market-competitors ~/.claude/skills/market-competitors

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file
skills/market-competitors/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to
~/.claude/skills/market-competitors
Collection
One of 15 skills cataloged from this repository
Category
Data668 skills

What Market Competitors does

Market Competitors analyzes competitor websites, pricing, features, and SEO to produce a comprehensive report revealing positioning gaps and differentiation opportunities. Use it when you need actionable competitive intelligence for marketing decisions.

Market Competitors is cataloged under Data on DirSkills. Market Competitors comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

Competitive Intelligence Analysis

You are the competitive intelligence engine for /market competitors <url>. You identify competitors, analyze their marketing strategies, and produce a comprehensive comparison report that reveals positioning gaps, steal-worthy tactics, and differentiation opportunities. Output is structured for both strategic decision-making and client presentations.

When This Skill Is Invoked

The user runs /market competitors <url>. Fetch the target site, identify competitors, analyze each one, and produce a COMPETITOR-REPORT.md with actionable intelligence.


This is the opening of the README. Read the full README on GitHub.

Commands Market Competitors provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

  • /market

Frequently asked about Market Competitors

  • What else does zubair-trabzada publish alongside Market Competitors?

    Market Competitors is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Brand Voice Analysis, Client Proposal Generator and Copywriting Analysis & Generation. Each one is a separate skill with its own page in this directory, installs the same way Market Competitors does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.

  • How does Market Competitors compare to other Data skills?

    Market Competitors ranks #320 by stars among the 668 Data skills in this catalog. The most-starred ones next to it are Benchmark Methodology, Jupyter Notebook and Solana. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of Market Competitors against them. Open each page to compare what they document and how they install.

More from zubair-trabzada/ai-marketing-claude

Market Competitors is one of 15 skills cataloged on DirSkills from zubair-trabzada/ai-marketing-claude.

See all 15 skills
🎙️
2w ago

Brand Voice Analysis

Brand Voice Analysis examines a brand's voice, tone, and messaging across its website, social media, and other content to produce actionable brand voice guidelines. Use it to document voice patterns, ensure consistency across channels, or benchmark against competitors.
Writing
2.5K692
📄
2w ago

Client Proposal Generator

Client Proposal Generator creates professional, client-ready marketing service proposals that include situation analysis, phased strategy, scoped deliverables, pricing with tiered options, and ROI projections. Use it after a discovery call to formalize a prospective client engagement or to generate a reusable proposal template.
Writing
2.5K692
✍️
2w ago

Copywriting Analysis & Generation

Copywriting Analysis & Generation analyzes website copy, scores it across clarity, persuasion, specificity, emotion, and action, and generates optimized alternatives with before/after examples using proven copywriting frameworks.
Writing
2.5K692
✉️
2w ago

Email Sequence Generator

Email Sequence Generator creates complete, ready-to-send email sequences with subject lines, body copy, timing, and segmentation strategies. Use it to build welcome, nurture, launch, re-engagement, onboarding, cart abandonment, and cold outreach campaigns based on proven email frameworks.
Writing
2.5K692
📈
2w ago

Landing Page CRO Analysis

Landing Page CRO Analysis audits any landing page URL and produces a section-by-section teardown with prioritized, actionable conversion rate optimization fixes. Use it when asked for landing page feedback, conversion optimization, or a review to improve signups, leads, or purchases.
Frontend
2.5K692
✍️
2w ago

Market

Market runs marketing audits, generates copy, emails, social content, ads, and client reports from the command line.
Writing
2.5K692