📊
DataPython

Market Funnel

by zubair-trabzada

Market Funnel is a Data skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02
ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo
Install in seconds
Install Market Funnel
Copy Market Funnel into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.
terminal
npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/skills/market-funnel ~/.claude/skills/market-funnel

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file
skills/market-funnel/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to
~/.claude/skills/market-funnel
Collection
One of 15 skills cataloged from this repository
Category
Data668 skills

What Market Funnel does

Market Funnel maps the complete conversion path from first visit to purchase, identifies drop-off points, and recommends optimizations with revenue impact estimates. Use it to analyze a live website's funnel, quantify friction, and prioritize improvements.

Market Funnel is cataloged under Data on DirSkills. Market Funnel comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

Sales Funnel Analysis & Optimization

You are the funnel analysis engine for /market funnel <url>. You map the complete conversion path from first visit to purchase, identify drop-off points, quantify friction, and recommend specific optimizations with revenue impact estimates. Every recommendation is prioritized by estimated lift and implementation effort.

When This Skill Is Invoked

The user runs /market funnel <url>. Fetch the target site and trace every step a visitor takes from landing to conversion. Analyze each step for friction, clarity, and effectiveness. Output a complete analysis to FUNNEL-ANALYSIS.md.


This is the opening of the README. Read the full README on GitHub.

Commands Market Funnel provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

  • /market

Frequently asked about Market Funnel

  • What else does zubair-trabzada publish alongside Market Funnel?

    Market Funnel is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Brand Voice Analysis, Client Proposal Generator and Copywriting Analysis & Generation. Each one is a separate skill with its own page in this directory, installs the same way Market Funnel does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.

  • How does Market Funnel compare to other Data skills?

    Market Funnel ranks #321 by stars among the 668 Data skills in this catalog. The most-starred ones next to it are Benchmark Methodology, Jupyter Notebook and Solana. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of Market Funnel against them. Open each page to compare what they document and how they install.

More from zubair-trabzada/ai-marketing-claude

Market Funnel is one of 15 skills cataloged on DirSkills from zubair-trabzada/ai-marketing-claude.

See all 15 skills
🎙️
2w ago

Brand Voice Analysis

Brand Voice Analysis examines a brand's voice, tone, and messaging across its website, social media, and other content to produce actionable brand voice guidelines. Use it to document voice patterns, ensure consistency across channels, or benchmark against competitors.
Writing
2.5K692
📄
2w ago

Client Proposal Generator

Client Proposal Generator creates professional, client-ready marketing service proposals that include situation analysis, phased strategy, scoped deliverables, pricing with tiered options, and ROI projections. Use it after a discovery call to formalize a prospective client engagement or to generate a reusable proposal template.
Writing
2.5K692
✍️
2w ago

Copywriting Analysis & Generation

Copywriting Analysis & Generation analyzes website copy, scores it across clarity, persuasion, specificity, emotion, and action, and generates optimized alternatives with before/after examples using proven copywriting frameworks.
Writing
2.5K692
✉️
2w ago

Email Sequence Generator

Email Sequence Generator creates complete, ready-to-send email sequences with subject lines, body copy, timing, and segmentation strategies. Use it to build welcome, nurture, launch, re-engagement, onboarding, cart abandonment, and cold outreach campaigns based on proven email frameworks.
Writing
2.5K692
📈
2w ago

Landing Page CRO Analysis

Landing Page CRO Analysis audits any landing page URL and produces a section-by-section teardown with prioritized, actionable conversion rate optimization fixes. Use it when asked for landing page feedback, conversion optimization, or a review to improve signups, leads, or purchases.
Frontend
2.5K692
✍️
2w ago

Market

Market runs marketing audits, generates copy, emails, social content, ads, and client reports from the command line.
Writing
2.5K692