Market Report PDF

Market Report PDF is a Data skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02

ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo

Install in seconds

Install Market Report PDF

Copy Market Report PDF into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.

terminal

npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/skills/market-report-pdf ~/.claude/skills/market-report-pdf

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file: skills/market-report-pdf/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to: ~/.claude/skills/market-report-pdf
Collection: One of 15 skills cataloged from this repository
Category: Data — 668 skills

What Market Report PDF does

Market Report PDF generates a polished, branded PDF marketing report from gathered audit data, including score gauges, bar charts, comparison tables, findings, and prioritized action plans. Use it when a client-ready visual report is needed.

Market Report PDF is cataloged under Data on DirSkills. Market Report PDF comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

Excerpt

PDF Marketing Report Generator

Skill Purpose

Generate a professional, visually polished PDF marketing report using the Python script scripts/generate_pdf_report.py. This skill collects all available audit and analysis data, structures it into the expected JSON format, invokes the script, and produces a branded PDF with score gauges, bar charts, comparison tables, findings, and a prioritized action plan.

When to Use

User wants a PDF version of the marketing report (not just Markdown)
User is preparing a deliverable for a client presentation
User asks for a "polished report", "client-ready report", or "PDF report"
User wants a visual report with charts and scores
Triggered by /market report-pdf or /market report-pdf <domain>

When to Use PDF vs Markdown

This is the opening of the README. Read the full README on GitHub.

Commands Market Report PDF provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

/market

Frequently asked about Market Report PDF

What else does zubair-trabzada publish alongside Market Report PDF?
Market Report PDF is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Brand Voice Analysis, Client Proposal Generator and Copywriting Analysis & Generation. Each one is a separate skill with its own page in this directory, installs the same way Market Report PDF does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.
How does Market Report PDF compare to other Data skills?
Market Report PDF ranks #322 by stars among the 668 Data skills in this catalog. The most-starred ones next to it are Benchmark Methodology, Jupyter Notebook and Solana. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of Market Report PDF against them. Open each page to compare what they document and how they install.