📊
AutomationPython

Marketing Audit

by zubair-trabzada

Marketing Audit is an Automation skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02
ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo
Install in seconds
Install Marketing Audit
Copy Marketing Audit into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.
terminal
npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/skills/market-audit ~/.claude/skills/market-audit

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file
skills/market-audit/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to
~/.claude/skills/market-audit
Collection
One of 15 skills cataloged from this repository
Category
Automation1523 skills

What Marketing Audit does

Marketing Audit runs a full website audit by launching five parallel subagents that score content, conversion, SEO, competitive positioning, and growth strategy. It compiles a weighted Marketing Score and prioritized recommendations into a client-ready report.

Marketing Audit is cataloged under Automation on DirSkills. Marketing Audit comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

Marketing Audit Orchestrator

You are the full marketing audit engine for /market audit <url>. You launch 5 parallel subagents, aggregate their results, and produce a unified MARKETING-AUDIT.md report that is client-ready and revenue-focused.

When This Skill Is Invoked

The user runs /market audit <url>. This is the flagship command of the entire suite. It produces the most comprehensive deliverable: a scored, prioritized, actionable marketing audit.


This is the opening of the README. Read the full README on GitHub.

Commands Marketing Audit provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

  • /market

Frequently asked about Marketing Audit

  • What else does zubair-trabzada publish alongside Marketing Audit?

    Marketing Audit is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Brand Voice Analysis, Client Proposal Generator and Copywriting Analysis & Generation. Each one is a separate skill with its own page in this directory, installs the same way Marketing Audit does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.

  • How does Marketing Audit compare to other Automation skills?

    Marketing Audit ranks #455 by stars among the 1523 Automation skills in this catalog. The most-starred ones next to it are Autonomous Loops, Autonomous Agent Harness and Automation Audit Ops. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of Marketing Audit against them. Open each page to compare what they document and how they install.

More from zubair-trabzada/ai-marketing-claude

Marketing Audit is one of 15 skills cataloged on DirSkills from zubair-trabzada/ai-marketing-claude.

See all 15 skills
🎙️
2w ago

Brand Voice Analysis

Brand Voice Analysis examines a brand's voice, tone, and messaging across its website, social media, and other content to produce actionable brand voice guidelines. Use it to document voice patterns, ensure consistency across channels, or benchmark against competitors.
Writing
2.5K692
📄
2w ago

Client Proposal Generator

Client Proposal Generator creates professional, client-ready marketing service proposals that include situation analysis, phased strategy, scoped deliverables, pricing with tiered options, and ROI projections. Use it after a discovery call to formalize a prospective client engagement or to generate a reusable proposal template.
Writing
2.5K692
✍️
2w ago

Copywriting Analysis & Generation

Copywriting Analysis & Generation analyzes website copy, scores it across clarity, persuasion, specificity, emotion, and action, and generates optimized alternatives with before/after examples using proven copywriting frameworks.
Writing
2.5K692
✉️
2w ago

Email Sequence Generator

Email Sequence Generator creates complete, ready-to-send email sequences with subject lines, body copy, timing, and segmentation strategies. Use it to build welcome, nurture, launch, re-engagement, onboarding, cart abandonment, and cold outreach campaigns based on proven email frameworks.
Writing
2.5K692
📈
2w ago

Landing Page CRO Analysis

Landing Page CRO Analysis audits any landing page URL and produces a section-by-section teardown with prioritized, actionable conversion rate optimization fixes. Use it when asked for landing page feedback, conversion optimization, or a review to improve signups, leads, or purchases.
Frontend
2.5K692
✍️
2w ago

Market

Market runs marketing audits, generates copy, emails, social content, ads, and client reports from the command line.
Writing
2.5K692