Marketing Report Generator

Marketing Report Generator is a Data skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02

ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo

Install in seconds

Install Marketing Report Generator

Copy Marketing Report Generator into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.

terminal

npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/skills/market-report ~/.claude/skills/market-report

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file: skills/market-report/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to: ~/.claude/skills/market-report
Collection: One of 15 skills cataloged from this repository
Category: Data — 668 skills

What Marketing Report Generator does

Marketing Report Generator compiles audit data into a client-ready marketing report with scores, findings, recommendations, and a prioritized action plan. Use it after running audits like SEO, CRO, or brand analysis to produce a single comprehensive document.

Marketing Report Generator is cataloged under Data on DirSkills. Marketing Report Generator comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

Excerpt

Marketing Report Generator (Markdown Format)

Skill Purpose

Generate a comprehensive, professionally formatted marketing report in Markdown. This skill compiles data from all previous audit and analysis results into a single, client-ready document with scores, findings, recommendations, and a prioritized action plan with revenue impact estimates.

When to Use

User wants a full marketing report for a client or their own business
User has completed one or more audit skills and wants a compiled report
User asks for a marketing assessment, scorecard, or analysis document
Triggered by /market report or /market report <domain>

How to Execute

This is the opening of the README. Read the full README on GitHub.

Commands Marketing Report Generator provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

/market

Frequently asked about Marketing Report Generator

What else does zubair-trabzada publish alongside Marketing Report Generator?
Marketing Report Generator is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Brand Voice Analysis, Client Proposal Generator and Copywriting Analysis & Generation. Each one is a separate skill with its own page in this directory, installs the same way Marketing Report Generator does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.
How does Marketing Report Generator compare to other Data skills?
Marketing Report Generator ranks #323 by stars among the 668 Data skills in this catalog. The most-starred ones next to it are Benchmark Methodology, Jupyter Notebook and Solana. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of Marketing Report Generator against them. Open each page to compare what they document and how they install.