🔍
SEOPython

SEO Content Audit

by zubair-trabzada

SEO Content Audit is an SEO skill for Claude Code, published by zubair-trabzada in ai-marketing-claude.

2.5K stars692 forkson zubair-trabzada/ai-marketing-claudeAdded 2026/08/18+4% in starsRepository updated 2026/03/02
ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo
Install in seconds
Install SEO Content Audit
Copy SEO Content Audit into your Claude Code skills folder. Run the command in your terminal, or review the source on GitHub before installing.
terminal
npx degit https://github.com/zubair-trabzada/ai-marketing-claude/tree/main/skills/market-seo ~/.claude/skills/market-seo

Requires Node.js. Downloads this skill only — not the rest of the repository — into your Claude Code skills folder.

Without Node.js

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git

Clones the whole repository, then copy the skill’s own directory into your skills folder yourself.

In this catalog

Source file
skills/market-seo/SKILL.md in zubair-trabzada/ai-marketing-claude
Installs to
~/.claude/skills/market-seo
Collection
One of 15 skills cataloged from this repository
Category
SEO164 skills

What SEO Content Audit does

SEO Content Audit analyzes a webpage or website for on-page SEO, E-E-A-T content quality, keyword gaps, and technical issues, producing an actionable audit document. Use it when a user shares a URL and requests SEO analysis, ranking improvement advice, or content strategy recommendations.

SEO Content Audit is cataloged under SEO on DirSkills. SEO Content Audit comes from a repository tagged ai-marketing, claude, claude-code, competitive-analysis and content-strategy.

Documentation

README

SEO Content Audit

Skill Purpose

Perform a comprehensive SEO audit of a webpage or website, covering on-page SEO, content quality (E-E-A-T), keyword analysis, technical SEO, and content strategy. This skill combines automated analysis via scripts/analyze_page.py with expert-level manual review to produce an actionable SEO audit document.

When to Use

  • User provides a URL and asks for SEO analysis, audit, or recommendations
  • User wants to improve organic search rankings and traffic
  • User asks about on-page SEO, meta tags, content quality, or technical SEO
  • User wants a content gap analysis or content strategy recommendations
  • Triggered by /market seo <url> or /market seo

How to Execute

This is the opening of the README. Read the full README on GitHub.

Commands SEO Content Audit provides

Slash commands named in this skill’s SKILL.md, listed in the order they first appear.

  • /market
  • /robots
  • /sitemap

Frequently asked about SEO Content Audit

  • What else does zubair-trabzada publish alongside SEO Content Audit?

    SEO Content Audit is one of 15 skills that DirSkills catalogs from zubair-trabzada/ai-marketing-claude, the repository it ships in. Its siblings there include Brand Voice Analysis, Client Proposal Generator and Copywriting Analysis & Generation. Each one is a separate skill with its own page in this directory, installs the same way SEO Content Audit does, and is maintained by zubair-trabzada in that same repository. The rest of the collection is listed on the zubair-trabzada/ai-marketing-claude page.

  • How does SEO Content Audit compare to other SEO skills?

    SEO Content Audit ranks #42 by stars among the 164 SEO skills in this catalog. The most-starred ones next to it are App Store Optimization, Answer Engine Optimization and SEO Analysis. DirSkills ranks by the star count of the repository each skill ships in, so that order reflects how popular those repositories are rather than any review of SEO Content Audit against them. Open each page to compare what they document and how they install.

More from zubair-trabzada/ai-marketing-claude

SEO Content Audit is one of 15 skills cataloged on DirSkills from zubair-trabzada/ai-marketing-claude.

See all 15 skills
🎙️
2w ago

Brand Voice Analysis

Brand Voice Analysis examines a brand's voice, tone, and messaging across its website, social media, and other content to produce actionable brand voice guidelines. Use it to document voice patterns, ensure consistency across channels, or benchmark against competitors.
Writing
2.5K692
📄
2w ago

Client Proposal Generator

Client Proposal Generator creates professional, client-ready marketing service proposals that include situation analysis, phased strategy, scoped deliverables, pricing with tiered options, and ROI projections. Use it after a discovery call to formalize a prospective client engagement or to generate a reusable proposal template.
Writing
2.5K692
✍️
2w ago

Copywriting Analysis & Generation

Copywriting Analysis & Generation analyzes website copy, scores it across clarity, persuasion, specificity, emotion, and action, and generates optimized alternatives with before/after examples using proven copywriting frameworks.
Writing
2.5K692
✉️
2w ago

Email Sequence Generator

Email Sequence Generator creates complete, ready-to-send email sequences with subject lines, body copy, timing, and segmentation strategies. Use it to build welcome, nurture, launch, re-engagement, onboarding, cart abandonment, and cold outreach campaigns based on proven email frameworks.
Writing
2.5K692
📈
2w ago

Landing Page CRO Analysis

Landing Page CRO Analysis audits any landing page URL and produces a section-by-section teardown with prioritized, actionable conversion rate optimization fixes. Use it when asked for landing page feedback, conversion optimization, or a review to improve signups, leads, or purchases.
Frontend
2.5K692
✍️
2w ago

Market

Market runs marketing audits, generates copy, emails, social content, ads, and client reports from the command line.
Writing
2.5K692